PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Itr_sc000051.1_g00029.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Convolvulaceae; Ipomoeeae; Ipomoea
Family NAC
Protein Properties Length: 409aa    MW: 45949.2 Da    PI: 6.3774
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Itr_sc000051.1_g00029.1genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM171.13.4e-5361331128
                      NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp.k.kvkaeekewyfFskrdkkyatgkrknratksgyWk 84 
                              lppGfrFhPtd+elv +yLk+k++g ++el evi+evd+yk++Pw+Lp k  + +++ ew+fF++rdkky++g+r+nratksgyWk
  Itr_sc000051.1_g00029.1   6 LPPGFRFHPTDDELVGYYLKRKTDGVEIEL-EVIPEVDLYKFDPWELPdKsFLPKRDMEWFFFCPRDKKYPNGSRTNRATKSGYWK 90 
                              79****************************.99**************96434556788**************************** PP

                      NAM  85 atgkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                              atgkd+++++ + ++vg +ktLvfy+grap g +tdWvmheyr+
  Itr_sc000051.1_g00029.1  91 ATGKDRRIVC-QPATVGYRKTLVFYRGRAPLGDRTDWVMHEYRI 133
                              **********.9999***************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019415.89E-604162IPR003441NAC domain
PROSITE profilePS5100558.0726162IPR003441NAC domain
PfamPF023654.5E-297133IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0008283Biological Processcell proliferation
GO:0071365Biological Processcellular response to auxin stimulus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 409 aa     Download sequence    Send to blast
MGGASLPPGF RFHPTDDELV GYYLKRKTDG VEIELEVIPE VDLYKFDPWE LPDKSFLPKR  60
DMEWFFFCPR DKKYPNGSRT NRATKSGYWK ATGKDRRIVC QPATVGYRKT LVFYRGRAPL  120
GDRTDWVMHE YRISDEDSHG NPSFQVPLDH KGPFALCRVI KKNEVSKKTT SEASGVTAAA  180
ASKETGSTSS HAGFSSSVAL NEPIILSDDI PTFMSTESNY STPIASPYQA SHMGDYEFGM  240
QPDTASVWMS ADMILDSSKE CPQQQNVPGF HSTQYGFPGS TLWQPYENHE LSSSSSYSNF  300
RGEVELSDDP SRYGSVSPYF GHGNYLGFYG NDGRPFEVHL PLIPSSKDQP PNRDHFLRSH  360
QESGYISAKL LNFDSNKLRV EEASLIRGTG TWRCFYSPCL SSIIALVFI
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A3e-52516816171NO APICAL MERISTEM PROTEIN
1ut4_B3e-52516816171NO APICAL MERISTEM PROTEIN
1ut7_A3e-52516816171NO APICAL MERISTEM PROTEIN
1ut7_B3e-52516816171NO APICAL MERISTEM PROTEIN
4dul_A3e-52516816171NAC domain-containing protein 19
4dul_B3e-52516816171NAC domain-containing protein 19
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00439DAPTransfer from AT4G17980Download
Motif logo
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016575709.11e-158PREDICTED: NAC domain-containing protein 45-like
TrEMBLK4CN711e-157K4CN71_SOLLC; Uncharacterized protein
STRINGSolyc08g077110.2.11e-156(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA62561635
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G17980.12e-92NAC domain containing protein 71